Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HSD17B13 Peptide - N-terminal region

HSD17B13 Peptide - N-terminal region

Product Specifications

Product Name Alternative

NIIL497, SCDR9, SDR16C3

UniProt

Q7Z5P4

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with HSD17B13 Rabbit Polyclonal Antibody (orb587025) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_835236

Preservative

Lyophilized powder

AA Sequence

VVDCSNREEIYRSLNQVKKEVGDVTIVVNNAGTVYPADLLSTKDEEITKT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human IFNA4 Protein, His Tag
E40KMPH1474 20 µg

Human IFNA4 Protein, His Tag

Sign In for Pricing
View Details
Human B3GALT5 Recombinant Protein
PPT-10782 100 µg

Human B3GALT5 Recombinant Protein

Sign In for Pricing
View Details
Migration Inhibitory Factor-Related Protein 8 (MRP8) Antibody
abx430267 200 µL

Migration Inhibitory Factor-Related Protein 8 (MRP8) Antibody

Sign In for Pricing
View Details
Mouse Cathelicidin antimicrobial peptide (CAMP) ELISA Kit
MBS2612009-01 48 Well

Mouse Cathelicidin antimicrobial peptide (CAMP) ELISA Kit

Sign In for Pricing
View Details
Mouse Cathelicidin antimicrobial peptide (CAMP) ELISA Kit
MBS2612009-02 96 Well

Mouse Cathelicidin antimicrobial peptide (CAMP) ELISA Kit

Sign In for Pricing
View Details
Mouse Cathelicidin antimicrobial peptide (CAMP) ELISA Kit
MBS2612009-03 5x 96 Well

Mouse Cathelicidin antimicrobial peptide (CAMP) ELISA Kit

Sign In for Pricing
View Details