Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IBA57 Peptide - N-terminal region

IBA57 Peptide - N-terminal region

Product Specifications

Product Name Alternative

C1orf69

UniProt

Q5T440

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with IBA57 Rabbit Polyclonal Antibody (orb326758) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001010867

Preservative

Lyophilized powder

AA Sequence

ILYGLQEHSEVSGFLLECDSSVQGALQKHLALYRIRRKVTVEPHPELRVW

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD81 / TAPA-1 (1.3.3.22), CF488A conjugate, 0.1mg/mL
BNC880391-500 1x 500 µL

CD81 / TAPA-1 (1.3.3.22), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD4 (EDU-2), CF740 conjugate, 0.1mg/mL
BNC740345-500 1x 500 µL

CD4 (EDU-2), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin, LMW (AE-1), CF488A conjugate, 0.1mg/mL
BNC880253-100 1x 100 µL

Cytokeratin, LMW (AE-1), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MAGE A1 (MA454), CF568 conjugate, 0.1mg/mL
BNC680008-500 1x 500 µL

MAGE A1 (MA454), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
HSP27 (G3.1), CF488A conjugate, 0.1mg/mL
BNC880861-100 1x 100 µL

HSP27 (G3.1), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
FOXP3 (3G3), CF647 conjugate, 0.1mg/mL
BNC470645-500 1x 500 µL

FOXP3 (3G3), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details