Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Alpha-cobratoxin

α-cobratoxin (alpha-elapitoxin-Nk2a) has been isolated from the venom of the Naja kaouthia cobra snake. α-cobratoxin preferentially blocks muscular and neuronal α 7/CHRNA7 nicotinic acetylcholine receptor (Kd = 55 pM) . α-cobratoxin is involved in paralysis by preventing acetylcholine binding to the nAChR. This toxin has shown to cause reduction of tumor growth in mice lung cancer.

Product Specifications

CAS Number

769933-79-1

Specifications

α7 nicotinic acetylcholine receptor (nAChR) antagonist

Target

Acetylcholine receptors

Sequence

IRCFITPDITSKDCPNGHVCYTKTWCDAFCSIRGKRVDLGCAATCPTVKTGVDIQCCSTDNCNPFPTRKRP

Peptide Number

CBT001

Disulfide Bonds

Cys3-Cys20; Cys14-Cys41; Cys26-Cys30; Cys45-Cys56; Cys57-Cys62

N Terminal Sequence

H

C Terminal Sequence

OH

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RPL5 Antibody
MBS8514442-01 0.1 mg

RPL5 Antibody

Sign In for Pricing
View Details
RPL5 Antibody
MBS8514442-02 0.1 mL (AF635)

RPL5 Antibody

Sign In for Pricing
View Details
RPL5 Antibody
MBS8514442-03 0.1 mL (AF610)

RPL5 Antibody

Sign In for Pricing
View Details
RPL5 Antibody
MBS8514442-04 0.1 mL (AF405S)

RPL5 Antibody

Sign In for Pricing
View Details
RPL5 Antibody
MBS8514442-05 0.1 mL (AF405L)

RPL5 Antibody

Sign In for Pricing
View Details
RPL5 Antibody
MBS8514442-06 0.1 mL (AF546)

RPL5 Antibody

Sign In for Pricing
View Details