Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OR11A1 Peptide - C-terminal region

OR11A1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

OR11A2, dJ994E9.6, hs6M1-18

UniProt

Q9GZK7

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with OR11A1 Rabbit Polyclonal Antibody (orb587055) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_039225

Preservative

Lyophilized powder

AA Sequence

YVAPSAVHSQLLSKVFSLLYTVVTPLFNPVIYTMRNKEVHQALRKILCIK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Hydrocortisone-2,2,4,6,6,21,21-d7 (d6 Major)(Cortisol)
TRC-H714617-25MG 25 mg

Hydrocortisone-2,2,4,6,6,21,21-d7 (d6 Major)(Cortisol)

Sign In for Pricing
View Details
LEPR Polyclonal Antibody
E-AB-53262-01 20 µL

LEPR Polyclonal Antibody

Sign In for Pricing
View Details
LEPR Polyclonal Antibody
E-AB-53262-02 60 µL

LEPR Polyclonal Antibody

Sign In for Pricing
View Details
LEPR Polyclonal Antibody
E-AB-53262-03 120 µL

LEPR Polyclonal Antibody

Sign In for Pricing
View Details
LEPR Polyclonal Antibody
E-AB-53262-04 200 µL

LEPR Polyclonal Antibody

Sign In for Pricing
View Details
Recombinant Human CFHR4 Protein (His Tag)
PKSH033710-01 10 µg

Recombinant Human CFHR4 Protein (His Tag)

Sign In for Pricing
View Details