Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OR11A1 Peptide - C-terminal region

OR11A1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

OR11A2, dJ994E9.6, hs6M1-18

UniProt

Q9GZK7

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with OR11A1 Rabbit Polyclonal Antibody (orb587055) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_039225

Preservative

Lyophilized powder

AA Sequence

YVAPSAVHSQLLSKVFSLLYTVVTPLFNPVIYTMRNKEVHQALRKILCIK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RBM3 (NM_006743) Human Recombinant Protein
TP760298 50 µg

RBM3 (NM_006743) Human Recombinant Protein

Sign In for Pricing
View Details
TRITC Conjugated Goat Polyclonal Antibody to Monkey IgG
RA-2305-1 1 mL

TRITC Conjugated Goat Polyclonal Antibody to Monkey IgG

Sign In for Pricing
View Details
Human GDNF, Tag Free
HA211323-01 20 µg

Human GDNF, Tag Free

Sign In for Pricing
View Details
Human GDNF, Tag Free
HA211323-02 50 µg

Human GDNF, Tag Free

Sign In for Pricing
View Details
Human GDNF, Tag Free
HA211323-03 100 µg

Human GDNF, Tag Free

Sign In for Pricing
View Details
PerCP/Cyanine5.5 Anti-Human CD79a Antibody[HM47]
E-AB-F1370J-01 20 Tests

PerCP/Cyanine5.5 Anti-Human CD79a Antibody[HM47]

Sign In for Pricing
View Details