Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DMAC2L Peptide - N-terminal region

DMAC2L Peptide - N-terminal region

Product Specifications

Product Name Alternative

FB, ATPW, ATP5S, HSU79253

UniProt

Q99766

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with DMAC2L Rabbit Polyclonal Antibody (orb587057) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001003803

Preservative

Lyophilized powder

AA Sequence

LRCGAMVRYHGQERWQKDYNHLPTGPLDKYKIQAIDATDSCIMSIGFDHM

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Clostridium botulinum Botulinum neurotoxin type A (botA), partial
orb1631517-01 20 µg

Recombinant Clostridium botulinum Botulinum neurotoxin type A (botA), partial

Sign In for Pricing
View Details
Recombinant Clostridium botulinum Botulinum neurotoxin type A (botA), partial
orb1631517-02 100 µg

Recombinant Clostridium botulinum Botulinum neurotoxin type A (botA), partial

Sign In for Pricing
View Details
Recombinant Clostridium botulinum Botulinum neurotoxin type A (botA), partial
orb1631517-03 1 mg

Recombinant Clostridium botulinum Botulinum neurotoxin type A (botA), partial

Sign In for Pricing
View Details
Anti-FRMD6 (Rabbit, Polyclonal)
A113293 100 µL

Anti-FRMD6 (Rabbit, Polyclonal)

Sign In for Pricing
View Details
Lentiviral human KMT2B shRNA (UAS) - Lentiviral human KMT2B shRNA (UAS, iRFP) plasmid
GTR15147172 1 Vial

Lentiviral human KMT2B shRNA (UAS) - Lentiviral human KMT2B shRNA (UAS, iRFP) plasmid

Sign In for Pricing
View Details
Insulin (HRP)
I7656-07-HRP 100 µL

Insulin (HRP)

Sign In for Pricing
View Details