Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MACROD1 Peptide - N-terminal region

MACROD1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

LRP16

UniProt

Q9BQ69

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with MACROD1 Rabbit Polyclonal Antibody (orb587060) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_054786

Preservative

Lyophilized powder

AA Sequence

MAAKVDLSTSTDWKEAKSFLKGLSDKQREEHYFCKDFVRLKKIPTWKEMA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human PROZ (Protein Z) ELISA Kit
EK250760 96 Well

Human PROZ (Protein Z) ELISA Kit

Sign In for Pricing
View Details
Mouse 1700020L24Rik qPCR Primer Pair
QM31682S 200 Tests

Mouse 1700020L24Rik qPCR Primer Pair

Sign In for Pricing
View Details
TMEM130 siRNA Oligos set (Human)
46885171 3x 5 nmol

TMEM130 siRNA Oligos set (Human)

Sign In for Pricing
View Details
Cenpw sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 2)
K3503607 1.0 µg DNA

Cenpw sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 2)

Sign In for Pricing
View Details
Rat Angiotensin I (AngI) Mini Samples ELISA Kit
MBS2087601-01 24 Strip Well

Rat Angiotensin I (AngI) Mini Samples ELISA Kit

Sign In for Pricing
View Details
Rat Angiotensin I (AngI) Mini Samples ELISA Kit
MBS2087601-02 48 Well

Rat Angiotensin I (AngI) Mini Samples ELISA Kit

Sign In for Pricing
View Details