Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RRP15 Peptide - C-terminal region

RRP15 Peptide - C-terminal region

Product Specifications

Product Name Alternative

KIAA0507

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with RRP15 Rabbit Polyclonal Antibody (orb587064) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_057136

Preservative

Lyophilized powder

AA Sequence

ISTVSKKDFISVLRGMDGSTNETASSRKKPKAKQTEVKSEEGPGWTILRD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Kv4.2 Rabbit pAb, Pacific Blue conjugated
orb2827590 100 µL

Kv4.2 Rabbit pAb, Pacific Blue conjugated

Sign In for Pricing
View Details
MYLK2 (m) : 293 Lysate
sc-178974 100 µg - 200 µL

MYLK2 (m) : 293 Lysate

Sign In for Pricing
View Details
TS-50.80-514-PREARO-RD-RL Floor & Pavement Marking Die-cut Shapes
104526 52 Roll (52 Piece (s) x 1 Roll)

TS-50.80-514-PREARO-RD-RL Floor & Pavement Marking Die-cut Shapes

Sign In for Pricing
View Details
SETDB1 Overexpression Lysate (Native) - (Dry Ice)
NBP2-09749 0.1 mg

SETDB1 Overexpression Lysate (Native) - (Dry Ice)

Sign In for Pricing
View Details
group III sPLA2 CRISPR Activation Plasmid (m2)
sc-433569-ACT-2 20 µg

group III sPLA2 CRISPR Activation Plasmid (m2)

Sign In for Pricing
View Details
Rab31 Ras-associated, small GTP-binding protein human, recombinant, E. coli
PR-193 50 µg

Rab31 Ras-associated, small GTP-binding protein human, recombinant, E. coli

Sign In for Pricing
View Details