Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RRP15 Peptide - C-terminal region

RRP15 Peptide - C-terminal region

Product Specifications

Product Name Alternative

KIAA0507

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with RRP15 Rabbit Polyclonal Antibody (orb587064) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_057136

Preservative

Lyophilized powder

AA Sequence

ISTVSKKDFISVLRGMDGSTNETASSRKKPKAKQTEVKSEEGPGWTILRD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

A2LD1-set siRNA/shRNA/RNAi Lentivector (Human)
10926091 4x 500 ng

A2LD1-set siRNA/shRNA/RNAi Lentivector (Human)

Sign In for Pricing
View Details
SMUG1 Protein Vector (Human) (pPM-C-HA)
44484021 500 ng

SMUG1 Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details
Single Donor Human Male Perianal Swabs
MBS8421305-01 1 Sample

Single Donor Human Male Perianal Swabs

Sign In for Pricing
View Details
Single Donor Human Male Perianal Swabs
MBS8421305-02 5x 1 Sample

Single Donor Human Male Perianal Swabs

Sign In for Pricing
View Details
Immunoglobulin heavy constant alpha 2 (IGHA2) Antibody (FITC)
abx343587-01 20 µg

Immunoglobulin heavy constant alpha 2 (IGHA2) Antibody (FITC)

Sign In for Pricing
View Details
Immunoglobulin heavy constant alpha 2 (IGHA2) Antibody (FITC)
abx343587-02 50 µg

Immunoglobulin heavy constant alpha 2 (IGHA2) Antibody (FITC)

Sign In for Pricing
View Details