Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

C3orf32 Peptide - middle region

C3orf32 Peptide - middle region

Product Specifications

Product Name Alternative

SSU-2, fls485, C3orf32

UniProt

F5H2S5

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with C3orf32 Rabbit Polyclonal Antibody (orb587066) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001243677

Preservative

Lyophilized powder

AA Sequence

GRYKCSGCHGAGTVRCPSCCGAKRKAKQSRRCQLCAGSGRRRCSTCSGRG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue FFPE Sections, Myometrium
CS800657 5x 5 µm

Tissue FFPE Sections, Myometrium

Sign In for Pricing
View Details
Nintedanib Dimer Impurity
TRC-N478305-5MG 5 mg

Nintedanib Dimer Impurity

Sign In for Pricing
View Details
Trim23 Mouse Gene Knockout Kit (CRISPR)
KN518191 1 Kit

Trim23 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
FAM102B Human Gene Knockout Kit (CRISPR)
KN423497 1 Kit

FAM102B Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Recombinant FEN1 Monoclonal Antibody
AN301922L-01 50 µL

Recombinant FEN1 Monoclonal Antibody

Sign In for Pricing
View Details
Recombinant FEN1 Monoclonal Antibody
AN301922L-02 100 µL

Recombinant FEN1 Monoclonal Antibody

Sign In for Pricing
View Details