Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

C3orf32 Peptide - middle region

C3orf32 Peptide - middle region

Product Specifications

Product Name Alternative

SSU-2, fls485, C3orf32

UniProt

F5H2S5

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with C3orf32 Rabbit Polyclonal Antibody (orb587066) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001243677

Preservative

Lyophilized powder

AA Sequence

GRYKCSGCHGAGTVRCPSCCGAKRKAKQSRRCQLCAGSGRRRCSTCSGRG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NAT1 (NM_001160170) Human Over-expression Lysate
LY431836 100 µg

NAT1 (NM_001160170) Human Over-expression Lysate

Sign In for Pricing
View Details
KIAA0100 Recombinant Mouse Monoclonal Antibody [A0-F3-R]
HA601317 100 µL

KIAA0100 Recombinant Mouse Monoclonal Antibody [A0-F3-R]

Sign In for Pricing
View Details
Maged1 (C-term) Rabbit Polyclonal Antibody
AP26048PU-N 100 µL

Maged1 (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Valnemulin Hydrochloride
TRC-V094400-10MG 10 mg

Valnemulin Hydrochloride

Sign In for Pricing
View Details
Mouse Gabra3 activation kit by CRISPRa
GA201515 1 Kit

Mouse Gabra3 activation kit by CRISPRa

Sign In for Pricing
View Details
PIAS3 Rabbit Polyclonal Antibody
TA379909 100 µL

PIAS3 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details