Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MARC2 Peptide - C-terminal region

MARC2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

MOSC2, RP11-270A6.1

UniProt

Q969Z3

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with MARC2 Rabbit Polyclonal Antibody (orb55725) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_060368

Preservative

Lyophilized powder

AA Sequence

ACPRCILTTVDPDTGVIDRKQPLDTLKSYRLCDPSERELYKLSPLFGIYY

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PRAF2 Polyclonal Antibody
MBS2516415-01 0.02 mL

PRAF2 Polyclonal Antibody

Sign In for Pricing
View Details
PRAF2 Polyclonal Antibody
MBS2516415-02 0.06 mL

PRAF2 Polyclonal Antibody

Sign In for Pricing
View Details
PRAF2 Polyclonal Antibody
MBS2516415-03 0.12 mL

PRAF2 Polyclonal Antibody

Sign In for Pricing
View Details
PRAF2 Polyclonal Antibody
MBS2516415-04 0.2 mL

PRAF2 Polyclonal Antibody

Sign In for Pricing
View Details
PRAF2 Polyclonal Antibody
MBS2516415-05 5x 0.2 mL

PRAF2 Polyclonal Antibody

Sign In for Pricing
View Details
TSPAN10 Rabbit Polyclonal Antibody (Biotin)
orb2112250 100 µL

TSPAN10 Rabbit Polyclonal Antibody (Biotin)

Sign In for Pricing
View Details