Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MARC2 Peptide - C-terminal region

MARC2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

MOSC2, RP11-270A6.1

UniProt

Q969Z3

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with MARC2 Rabbit Polyclonal Antibody (orb55725) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_060368

Preservative

Lyophilized powder

AA Sequence

ACPRCILTTVDPDTGVIDRKQPLDTLKSYRLCDPSERELYKLSPLFGIYY

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Hexokinase 1 Antibody / HK1
V5725-20UG 20 µg

Hexokinase 1 Antibody / HK1

Sign In for Pricing
View Details
Bovine Complement Component 8b ELISA kit
GTR10397906 96 Well

Bovine Complement Component 8b ELISA kit

Sign In for Pricing
View Details
UNC5CL (m) -PR
sc-154921-PR 10 µM - 20 µL

UNC5CL (m) -PR

Sign In for Pricing
View Details
Recombinant Mouse LAG-3/CD223 Protein, His Tag
E40KMP1656 20 µg

Recombinant Mouse LAG-3/CD223 Protein, His Tag

Sign In for Pricing
View Details
MGAT4C AAV Vector (Rat) (CMV)
28474106 1 µg

MGAT4C AAV Vector (Rat) (CMV)

Sign In for Pricing
View Details
4-Phenylthiophene-2-carboxylic acid
OR102883-01 1 g

4-Phenylthiophene-2-carboxylic acid

Sign In for Pricing
View Details