Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CCDC198 Peptide - C-terminal region

CCDC198 Peptide - C-terminal region

Product Specifications

Product Name Alternative

C14orf105

UniProt

Q9NVL8

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CCDC198 Rabbit Polyclonal Antibody (orb587082) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_060638

Preservative

Lyophilized powder

AA Sequence

WKIGKMETWLHEQEAQGQLLWDSSSSDSDEQGKDEKKPRALVRTRTERIP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD30 / TNFRSF8 (Hodgkin & Reed-Sternberg Cell Marker) (Ki-1/1747R), CF488A conjugate, 0.1mg/mL
BNC881747-100 1x 100 µL

CD30 / TNFRSF8 (Hodgkin & Reed-Sternberg Cell Marker) (Ki-1/1747R), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
2,3,4,5,6-Pentachlorobenzonitrile
TRC-P220470-25G 25 g

2,3,4,5,6-Pentachlorobenzonitrile

Sign In for Pricing
View Details
PerCP/Cyanine5.5 Anti-Mouse F4/80 Antibody[CI:A3-1]
E-AB-F0995J-01 50 Tests

PerCP/Cyanine5.5 Anti-Mouse F4/80 Antibody[CI:A3-1]

Sign In for Pricing
View Details
PerCP/Cyanine5.5 Anti-Mouse F4/80 Antibody[CI:A3-1]
E-AB-F0995J-02 100 Tests

PerCP/Cyanine5.5 Anti-Mouse F4/80 Antibody[CI:A3-1]

Sign In for Pricing
View Details
PerCP/Cyanine5.5 Anti-Mouse F4/80 Antibody[CI:A3-1]
E-AB-F0995J-03 2x 100 Tests

PerCP/Cyanine5.5 Anti-Mouse F4/80 Antibody[CI:A3-1]

Sign In for Pricing
View Details
Tissue FFPE Sections, Esophagus
CS700991 5x 5 µm

Tissue FFPE Sections, Esophagus

Sign In for Pricing
View Details