Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CCDC198 Peptide - C-terminal region

CCDC198 Peptide - C-terminal region

Product Specifications

Product Name Alternative

C14orf105

UniProt

Q9NVL8

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CCDC198 Rabbit Polyclonal Antibody (orb587082) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_060638

Preservative

Lyophilized powder

AA Sequence

WKIGKMETWLHEQEAQGQLLWDSSSSDSDEQGKDEKKPRALVRTRTERIP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RAF1 Rabbit Polyclonal Antibody
AP20499PU-N 100 µg

RAF1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
ING2 Polyclonal Antibody
E-AB-14158-01 20 µL

ING2 Polyclonal Antibody

Sign In for Pricing
View Details
ING2 Polyclonal Antibody
E-AB-14158-02 60 µL

ING2 Polyclonal Antibody

Sign In for Pricing
View Details
ING2 Polyclonal Antibody
E-AB-14158-03 120 µL

ING2 Polyclonal Antibody

Sign In for Pricing
View Details
ING2 Polyclonal Antibody
E-AB-14158-04 200 µL

ING2 Polyclonal Antibody

Sign In for Pricing
View Details
ARX (NM_139058) Human Recombinant Protein
TP313771M 100 µg

ARX (NM_139058) Human Recombinant Protein

Sign In for Pricing
View Details