Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

VRTN Peptide - C-terminal region

VRTN Peptide - C-terminal region

Product Specifications

Product Name Alternative

C14orf115, vertnin

UniProt

Q9H8Y1

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with VRTN Rabbit Polyclonal Antibody (orb587084) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_060698

Preservative

Lyophilized powder

AA Sequence

GGQEAEEKQEKEAGRDVTAVMAPPVGASSEDVEGGPSREGALQEGATAQG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human CD314/KLRK1 Protein, C-His
bs-104164P-01 20 µg

Recombinant Human CD314/KLRK1 Protein, C-His

Sign In for Pricing
View Details
Recombinant Human CD314/KLRK1 Protein, C-His
bs-104164P-02 50 µg

Recombinant Human CD314/KLRK1 Protein, C-His

Sign In for Pricing
View Details
CHIC2, CT (CHIC2, BTL, Cysteine-rich hydrophobic domain 2 protein, BrX-like translocated in leukemia) (MaxLight 405) discontinued
033846-ML405 100 µL

CHIC2, CT (CHIC2, BTL, Cysteine-rich hydrophobic domain 2 protein, BrX-like translocated in leukemia) (MaxLight 405) discontinued

Sign In for Pricing
View Details
Phospho-Beta catenin (Tyr142) Polyclonal Antibody, APC Conjugated
bs-2063R-APC 100 µL

Phospho-Beta catenin (Tyr142) Polyclonal Antibody, APC Conjugated

Sign In for Pricing
View Details
SORCS1 Protein Vector (Human) (pPM-C-HA)
45117021 500 ng

SORCS1 Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details
Multiplex Assay Kit for Macrophage Inflammatory Protein 1 Gamma (MIP1g), etc. by FLIA (Flow Luminescence Immunoassay)
TRV-0028961 96 Tests

Multiplex Assay Kit for Macrophage Inflammatory Protein 1 Gamma (MIP1g), etc. by FLIA (Flow Luminescence Immunoassay)

Sign In for Pricing
View Details