Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

VRTN Peptide - C-terminal region

VRTN Peptide - C-terminal region

Product Specifications

Product Name Alternative

C14orf115, vertnin

UniProt

Q9H8Y1

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with VRTN Rabbit Polyclonal Antibody (orb587084) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_060698

Preservative

Lyophilized powder

AA Sequence

GGQEAEEKQEKEAGRDVTAVMAPPVGASSEDVEGGPSREGALQEGATAQG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral human SULT1C3 shRNA (UAS) - Lentiviral human SULT1C3 shRNA (UAS, iRFP) (25)
GTR15343445 1 Vial

Lentiviral human SULT1C3 shRNA (UAS) - Lentiviral human SULT1C3 shRNA (UAS, iRFP) (25)

Sign In for Pricing
View Details
Human PHF21A Knockout A549 cell line
GTR15411342 1 Vial

Human PHF21A Knockout A549 cell line

Sign In for Pricing
View Details
Benzaldehyde
162764 100 g

Benzaldehyde

Sign In for Pricing
View Details
Rel- (2R,3R) -2-Phenylpiperidin-3-amine dihydrochloride
TYD-03546-01 10 mg

Rel- (2R,3R) -2-Phenylpiperidin-3-amine dihydrochloride

Sign In for Pricing
View Details
Rel- (2R,3R) -2-Phenylpiperidin-3-amine dihydrochloride
TYD-03546-02 50 mg

Rel- (2R,3R) -2-Phenylpiperidin-3-amine dihydrochloride

Sign In for Pricing
View Details
Bile Acid Receptor (NR1H4) Antibody
abx376011 100 µg

Bile Acid Receptor (NR1H4) Antibody

Sign In for Pricing
View Details