Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ANKRD10 Peptide - C-terminal region

ANKRD10 Peptide - C-terminal region

Product Specifications

UniProt

Q9NXR5

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ANKRD10 Rabbit Polyclonal Antibody (orb326788) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_060134

Preservative

Lyophilized powder

AA Sequence

SQGSLCISGTEEPEKTLRANPELCGSLHLNGSPSSCIASRPSWVEDIGDN

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TIGD7 Antibody - C-terminal region : HRP (ARP67859_P050-HRP)
ARP67859_P050-HRP 100 µL

TIGD7 Antibody - C-terminal region : HRP (ARP67859_P050-HRP)

Sign In for Pricing
View Details
GCS1 Antibody Blocking peptide
orb1450934 500 µg

GCS1 Antibody Blocking peptide

Sign In for Pricing
View Details
FBLN7 Protein Vector (Human) (pPB-N-His)
PV052006 500 ng

FBLN7 Protein Vector (Human) (pPB-N-His)

Sign In for Pricing
View Details
TXTP Antibody (Center)
orb1430351-01 50 µL

TXTP Antibody (Center)

Sign In for Pricing
View Details
TXTP Antibody (Center)
orb1430351-02 100 µL

TXTP Antibody (Center)

Sign In for Pricing
View Details
V1ra8 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)
K3053805 3x 1.0 µg

V1ra8 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)

Sign In for Pricing
View Details