Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ANKRD10 Peptide - C-terminal region

ANKRD10 Peptide - C-terminal region

Product Specifications

UniProt

Q9NXR5

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ANKRD10 Rabbit Polyclonal Antibody (orb326788) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_060134

Preservative

Lyophilized powder

AA Sequence

SQGSLCISGTEEPEKTLRANPELCGSLHLNGSPSSCIASRPSWVEDIGDN

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

OVA (257-264)
orb1147066 1 mg

OVA (257-264)

Sign In for Pricing
View Details
Reelin (RELN) Monoclonal Antibody
CAU33753-01 100 µL

Reelin (RELN) Monoclonal Antibody

Sign In for Pricing
View Details
Reelin (RELN) Monoclonal Antibody
CAU33753-02 200 µL

Reelin (RELN) Monoclonal Antibody

Sign In for Pricing
View Details
Reelin (RELN) Monoclonal Antibody
CAU33753-03 1 mL

Reelin (RELN) Monoclonal Antibody

Sign In for Pricing
View Details
Midi plus-1, 10 x 7cm UV Tray
ME10-UV7 1 Unit

Midi plus-1, 10 x 7cm UV Tray

Sign In for Pricing
View Details
OR52R1 Polyclonal Antibody, APC Conjugated
bs-17910R-APC 100 µL

OR52R1 Polyclonal Antibody, APC Conjugated

Sign In for Pricing
View Details