Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

VPS50 Peptide - N-terminal region

VPS50 Peptide - N-terminal region

Product Specifications

Product Name Alternative

VPS54L, CCDC132

UniProt

B3KX22

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with VPS50 Rabbit Polyclonal Antibody (orb326789) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001244927

Preservative

Lyophilized powder

AA Sequence

ELREQPSDPQAEQELINSIEQVYFSVDSFDIVKYELEKLPPVLNLQELEA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Metapramine
TRC-M225830-25MG 25 mg

Metapramine

Sign In for Pricing
View Details
Frozen Tissue Blocks, Prostate
CB548371 1 Block

Frozen Tissue Blocks, Prostate

Sign In for Pricing
View Details
CD3e (T-Cell Marker) (UCHT1), CF640R conjugate, 0.1mg/mL
BNC402473-100 1x 100 µL

CD3e (T-Cell Marker) (UCHT1), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Ep-CAM / CD326 (Epithelial Marker) (rMOC-31), CF640R conjugate, 0.1mg/mL
BNC401819-100 1x 100 µL

Ep-CAM / CD326 (Epithelial Marker) (rMOC-31), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Recombinant Human KEAP1/INRF2 Protein (His & GST & AVI Tag)
PKSH030944 100 µg

Recombinant Human KEAP1/INRF2 Protein (His & GST & AVI Tag)

Sign In for Pricing
View Details
1-Hexen-3-one (>90%)
TRC-H295020-1G 1 g

1-Hexen-3-one (>90%)

Sign In for Pricing
View Details