RABL6 Peptide - N-terminal region
RABL6 Peptide - N-terminal region
Product Specifications
Product Name Alternative
C9orf86, PARF, RBEL1, pp8875
UniProt
Q3YEC7
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with RABL6 Rabbit Polyclonal Antibody (orb326791) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_001167460
Preservative
Lyophilized powder
AA Sequence
PFVEEYIPTQEIQVTSIHWSYKTTDDIVKVEVWDVVDKGKCKKRGDGLKM
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
![Prominin 2 (PROM2) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI5E5]](https://cdn.genprice.uk/products/937/68dd1b64061270361ea13907/imageurl/ta500310bm.webp)
TA500310BM 100 µL
Prominin 2 (PROM2) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI5E5]
Sign In for Pricing
View Details 
LC420027 20 µg
CLC7 (CLCN7) (NM_001287) Human Over-expression Lysate
Sign In for Pricing
View Details 
BNC882296-500 1x 500 µL
ACTH (Adrenocorticotrophic Hormone) (Pituitary Marker) (rCLIP/1407), CF488A conjugate, 0.1mg/mL
Sign In for Pricing
View Details 