Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RABL6 Peptide - N-terminal region

RABL6 Peptide - N-terminal region

Product Specifications

Product Name Alternative

C9orf86, PARF, RBEL1, pp8875

UniProt

Q3YEC7

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with RABL6 Rabbit Polyclonal Antibody (orb326791) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001167460

Preservative

Lyophilized powder

AA Sequence

PFVEEYIPTQEIQVTSIHWSYKTTDDIVKVEVWDVVDKGKCKKRGDGLKM

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant NG2 Antibody
RC-15529-01 50 μL

Recombinant NG2 Antibody

Sign In for Pricing
View Details
Recombinant NG2 Antibody
RC-15529-02 100 µL

Recombinant NG2 Antibody

Sign In for Pricing
View Details
Recombinant NG2 Antibody
RC-15529-03 1 mL

Recombinant NG2 Antibody

Sign In for Pricing
View Details
General 17-Hydroxyprogesterone (17-OHP) ELISA Kit
RDR-17-OHP-Ge-01 96 Tests

General 17-Hydroxyprogesterone (17-OHP) ELISA Kit

Sign In for Pricing
View Details
General 17-Hydroxyprogesterone (17-OHP) ELISA Kit
RDR-17-OHP-Ge-02 48 Tests

General 17-Hydroxyprogesterone (17-OHP) ELISA Kit

Sign In for Pricing
View Details
Ugt1a6a Mouse Gene Knockout Kit (CRISPR)
KN518667 1 Kit

Ugt1a6a Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details