Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MAB21L4 Peptide - C-terminal region

MAB21L4 Peptide - C-terminal region

Product Specifications

Product Name Alternative

C2orf54

UniProt

Q08AI8

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with MAB21L4 Rabbit Polyclonal Antibody (orb587140) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001078906

Preservative

Lyophilized powder

AA Sequence

LKALLQLPASDPTYWATAYFDVLLDKFQVFNIQDKDRISAMQSIFQKTRT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GADD153 Conjugated Antibody
C29163 100 µL

GADD153 Conjugated Antibody

Sign In for Pricing
View Details
CD274 (B7-h1 Protein, B7-H1, B7H1, MGC142294, MGC142296, PD-L1, PDCD1L1, PDCD1LG1, PDL1) (APC)
MBS6468292-01 0.1 mL

CD274 (B7-h1 Protein, B7-H1, B7H1, MGC142294, MGC142296, PD-L1, PDCD1L1, PDCD1LG1, PDL1) (APC)

Sign In for Pricing
View Details
CD274 (B7-h1 Protein, B7-H1, B7H1, MGC142294, MGC142296, PD-L1, PDCD1L1, PDCD1LG1, PDL1) (APC)
MBS6468292-02 5x 0.1 mL

CD274 (B7-h1 Protein, B7-H1, B7H1, MGC142294, MGC142296, PD-L1, PDCD1L1, PDCD1LG1, PDL1) (APC)

Sign In for Pricing
View Details
MCM10 (Protein MCM10 Homolog, HsMCM10, PRO2249, F26H11_26, F26H11.26, CNA43, DNA43, HsMCM10, MGC126776) (MaxLight 650)
129491-ML650 100 µL

MCM10 (Protein MCM10 Homolog, HsMCM10, PRO2249, F26H11_26, F26H11.26, CNA43, DNA43, HsMCM10, MGC126776) (MaxLight 650)

Sign In for Pricing
View Details
NUMB Recombinant Protein
OPCD05843-200UG 200 µg

NUMB Recombinant Protein

Sign In for Pricing
View Details
Rabbit anti-Saccharomyces cerevisiae (strain 204508/S288c)(Baker's yeast) YML122C Polyclonal Antibody
MBS7150291 Inquire

Rabbit anti-Saccharomyces cerevisiae (strain 204508/S288c)(Baker's yeast) YML122C Polyclonal Antibody

Sign In for Pricing
View Details