Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MAB21L4 Peptide - C-terminal region

MAB21L4 Peptide - C-terminal region

Product Specifications

Product Name Alternative

C2orf54

UniProt

Q08AI8

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with MAB21L4 Rabbit Polyclonal Antibody (orb587140) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001078906

Preservative

Lyophilized powder

AA Sequence

LKALLQLPASDPTYWATAYFDVLLDKFQVFNIQDKDRISAMQSIFQKTRT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PLK2 3'UTR Lenti-reporter-Luc Vector
37018081 1.0 µg

PLK2 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details
MTF1 (Metal-Regulatory Transcription Factor 1, MGC23036, MTF-1, ZRF) (MaxLight 750)
MBS6239494-01 0.1 mL

MTF1 (Metal-Regulatory Transcription Factor 1, MGC23036, MTF-1, ZRF) (MaxLight 750)

Sign In for Pricing
View Details
MTF1 (Metal-Regulatory Transcription Factor 1, MGC23036, MTF-1, ZRF) (MaxLight 750)
MBS6239494-02 5x 0.1 mL

MTF1 (Metal-Regulatory Transcription Factor 1, MGC23036, MTF-1, ZRF) (MaxLight 750)

Sign In for Pricing
View Details
CRABP2 Rabbit Polyclonal Antibody (Biotin)
orb2594751 100 µg

CRABP2 Rabbit Polyclonal Antibody (Biotin)

Sign In for Pricing
View Details
Recombinant Streptococcus agalactiae serotype III Ribonuclease 3 (rnc)
MBS1363070-01 0.02 mg (E-Coli)

Recombinant Streptococcus agalactiae serotype III Ribonuclease 3 (rnc)

Sign In for Pricing
View Details
Recombinant Streptococcus agalactiae serotype III Ribonuclease 3 (rnc)
MBS1363070-02 0.1 mg (E-Coli)

Recombinant Streptococcus agalactiae serotype III Ribonuclease 3 (rnc)

Sign In for Pricing
View Details