Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SLC35E1 Peptide - C-terminal region

SLC35E1 Peptide - C-terminal region

Product Specifications

UniProt

Q96K37

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SLC35E1 Rabbit Polyclonal Antibody (orb587142) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_079157

Preservative

Lyophilized powder

AA Sequence

MTAILGVFLYNKTKYDANQQARKHLLPVTTADLSSKERHRSPLEKPHNGL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

rac Perhexiline Maleate
TRC-P287320-25MG 25 mg

rac Perhexiline Maleate

Sign In for Pricing
View Details
P21WAF1 (Tumor Suppressor Protein) (rCIP1/823), CF640R conjugate, 0.1mg/mL
BNC402292-100 1x 100 µL

P21WAF1 (Tumor Suppressor Protein) (rCIP1/823), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human Breast Cancer Associated Fibroblas
CAF06 1000000 Cells

Human Breast Cancer Associated Fibroblas

Sign In for Pricing
View Details
Syp Mouse Gene Knockout Kit (CRISPR)
KN517072 1 Kit

Syp Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
3-Chloro-Vortioxetine Hydrobromide
TRC-C424140-5MG 5 mg

3-Chloro-Vortioxetine Hydrobromide

Sign In for Pricing
View Details
Spectrin beta III (SPTBN2) (rSPTBN2/1778), CF740 conjugate, 0.1mg/mL
BNC743647-500 1x 500 µL

Spectrin beta III (SPTBN2) (rSPTBN2/1778), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details