Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SLC35E1 Peptide - C-terminal region

SLC35E1 Peptide - C-terminal region

Product Specifications

UniProt

Q96K37

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SLC35E1 Rabbit Polyclonal Antibody (orb587142) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_079157

Preservative

Lyophilized powder

AA Sequence

MTAILGVFLYNKTKYDANQQARKHLLPVTTADLSSKERHRSPLEKPHNGL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse IgA (Immunoglobulin A) ELISA Kit
E-EL-M0690-01 24 Tests

Mouse IgA (Immunoglobulin A) ELISA Kit

Sign In for Pricing
View Details
Mouse IgA (Immunoglobulin A) ELISA Kit
E-EL-M0690-02 48 Tests

Mouse IgA (Immunoglobulin A) ELISA Kit

Sign In for Pricing
View Details
Mouse IgA (Immunoglobulin A) ELISA Kit
E-EL-M0690-03 96 Tests

Mouse IgA (Immunoglobulin A) ELISA Kit

Sign In for Pricing
View Details
CDK6 (NM_001259) Human Over-expression Lysate
LY400506 100 µg

CDK6 (NM_001259) Human Over-expression Lysate

Sign In for Pricing
View Details
Ptprb Mouse Gene Knockout Kit (CRISPR)
KN514224 1 Kit

Ptprb Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
CLECL1 Human Gene Knockout Kit (CRISPR)
KN210857BN 1 Kit

CLECL1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details