ANKRD53 Peptide - N-terminal region
ANKRD53 Peptide - N-terminal region
Product Specifications
UniProt
Q8N9V6
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with ANKRD53 Rabbit Polyclonal Antibody (orb55726) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_079209
Preservative
Lyophilized powder
AA Sequence
RPASLTPPRADPSPSKESDQTAIDQTAIGSYYQLFAAAVGNVEWLRFCLN
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS6443559-01 0.1 mL
XRCC2 (X-ray Repair Cross-complementing Protein 2, DKFZp781P0919) (Biotin)
Sign In for Pricing
View Details MBS6443559-02 5x 0.1 mL
XRCC2 (X-ray Repair Cross-complementing Protein 2, DKFZp781P0919) (Biotin)
Sign In for Pricing
View Details 
ARP51614_P050-HRP 100 µL
CRIP1 Antibody - N-terminal region : HRP (ARP51614_P050-HRP)
Sign In for Pricing
View Details 
130675-AP 100 µL
OAS1 (2', 5'-Oligoadenylate Synthetase 1, (2-5') oligo (A) Synthase 1, 2-5A Synthase 1, E18/E16, p46/p42 OAS, OIAS) (AP) discontinued
Sign In for Pricing
View Details MBS1484595-01 0.02 mg (E-Coli)
Recombinant Clostridium perfringens tRNA modification GTPase MnmE (mnmE)
Sign In for Pricing
View Details MBS1484595-02 0.02 mg (Yeast)
Recombinant Clostridium perfringens tRNA modification GTPase MnmE (mnmE)
Sign In for Pricing
View Details