Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

C3orf36 Peptide - C-terminal region

C3orf36 Peptide - C-terminal region

Product Specifications

UniProt

Q3SXR2

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with C3orf36 Rabbit Polyclonal Antibody (orb587146) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_079317

Preservative

Lyophilized powder

AA Sequence

ALSGRGGGRCSIPSLSSSSTFSLFSSGCWNPRVKLRVRKSQSQGRAGQLI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Primer Panel
HPP6015A 3x 96 Pre-Arrayed Plates

Primer Panel

Sign In for Pricing
View Details
Dppa5 (BC092353) Mouse Tagged ORF Clone
MG200548 10 µg

Dppa5 (BC092353) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Recombinant Cbx3 Antibody
RC-4980-01 50 μL

Recombinant Cbx3 Antibody

Sign In for Pricing
View Details
Recombinant Cbx3 Antibody
RC-4980-02 100 µL

Recombinant Cbx3 Antibody

Sign In for Pricing
View Details
Recombinant Cbx3 Antibody
RC-4980-03 1 mL

Recombinant Cbx3 Antibody

Sign In for Pricing
View Details
Ep-CAM / CD326 (EGP40/1120), CF405S conjugate, 0.1mg/mL
BNC041120-500 1x 500 µL

Ep-CAM / CD326 (EGP40/1120), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details