Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

C3orf36 Peptide - C-terminal region

C3orf36 Peptide - C-terminal region

Product Specifications

UniProt

Q3SXR2

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with C3orf36 Rabbit Polyclonal Antibody (orb587146) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_079317

Preservative

Lyophilized powder

AA Sequence

ALSGRGGGRCSIPSLSSSSTFSLFSSGCWNPRVKLRVRKSQSQGRAGQLI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Neurog3 activation kit by CRISPRa
GA200313 1 Kit

Mouse Neurog3 activation kit by CRISPRa

Sign In for Pricing
View Details
Tissue Total RNA, Lung
CR559543 5 µg

Tissue Total RNA, Lung

Sign In for Pricing
View Details
LINC02145 Mouse Monoclonal Antibody [Clone ID: OTI9E9]
CF810646 100 µg

LINC02145 Mouse Monoclonal Antibody [Clone ID: OTI9E9]

Sign In for Pricing
View Details
ErbB 4 (ERBB4) (NM_001042599) Human Over-expression Lysate
LY421001 100 µg

ErbB 4 (ERBB4) (NM_001042599) Human Over-expression Lysate

Sign In for Pricing
View Details
GLYCTK (NM_145262) Human Recombinant Protein
TP308348 20 µg

GLYCTK (NM_145262) Human Recombinant Protein

Sign In for Pricing
View Details
PAN2 (C-term) Rabbit Polyclonal Antibody
AP53157PU-N 400 µL

PAN2 (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details