Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ARMC9 Peptide - N-terminal region

ARMC9 Peptide - N-terminal region

Product Specifications

Product Name Alternative

ARM, KU-MEL-1

UniProt

Q7Z3E5

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ARMC9 Rabbit Polyclonal Antibody (orb587149) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_079415

Preservative

Lyophilized powder

AA Sequence

DSFAQKLEFYLHIHFAIYLLKYSVGRPDKEELDEKISYFKTYLETKGAAL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Solute carrier family 12 member 2,SLC12A2 ELISA KIT
JOT-EK1591Mo-01 96 Well

Mouse Solute carrier family 12 member 2,SLC12A2 ELISA KIT

Sign In for Pricing
View Details
Mouse Solute carrier family 12 member 2,SLC12A2 ELISA KIT
JOT-EK1591Mo-02 48 Well

Mouse Solute carrier family 12 member 2,SLC12A2 ELISA KIT

Sign In for Pricing
View Details
Z-Arg-Arg-pNA · 2 HCl
4008026.005 50 mg

Z-Arg-Arg-pNA · 2 HCl

Sign In for Pricing
View Details
RCN2 CRISPRa sgRNA lentivector (set of three targets)(Rat)
38751126 3x 1.0µg DNA

RCN2 CRISPRa sgRNA lentivector (set of three targets)(Rat)

Sign In for Pricing
View Details
Human Taste receptor type 2 member 20 (TAS2R20) ELISA Kit
AE16479HU-01 48 Tests

Human Taste receptor type 2 member 20 (TAS2R20) ELISA Kit

Sign In for Pricing
View Details
Human Taste receptor type 2 member 20 (TAS2R20) ELISA Kit
AE16479HU-02 96 Tests

Human Taste receptor type 2 member 20 (TAS2R20) ELISA Kit

Sign In for Pricing
View Details