PTGES3L-AARSD1 Peptide - N-terminal region
PTGES3L-AARSD1 Peptide - N-terminal region
Product Specifications
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with PTGES3L-AARSD1 Rabbit Polyclonal Antibody (orb326815) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_001129514
Preservative
Lyophilized powder
AA Sequence
ELYNEIEFYAKVNSKDSQDKRSSRSITCFVRKWKEKVAWPRLTKEDIKPV
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC042216-100 1x 100 µL
CD50 / ICAM3 (CG106), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC040352-500 1x 500 µL
CD31 / PECAM-1 (158-2B3), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC880017-100 1x 100 µL
Ep-CAM / CD326 (VU-1D9), CF488A conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC040225-100 1x 100 µL
Major Vault Protein (MVP) (1032), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 