Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RCC1L Peptide - N-terminal region

RCC1L Peptide - N-terminal region

Product Specifications

Product Name Alternative

WBSCR16

UniProt

Q8IW88

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with RCC1L Rabbit Polyclonal Antibody (orb326818) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

AAH40695

Preservative

Lyophilized powder

AA Sequence

GYGFTLLSSKTADVTKVWGMGLNKDSQLGFHRSRKDKTRGYEYVLEPSPV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FYB1 (NM_001465) Human Recombinant Protein
TP314537L 1 mg

FYB1 (NM_001465) Human Recombinant Protein

Sign In for Pricing
View Details
UBTD2 Human Gene Knockout Kit (CRISPR)
KN414938 1 Kit

UBTD2 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Frozen Tissue Sections, Ovary: left
CS500666 5x 5 µm

Frozen Tissue Sections, Ovary: left

Sign In for Pricing
View Details
HEY2 Antibody
8C11818-AAT 50 µg

HEY2 Antibody

Sign In for Pricing
View Details
Tissue Total RNA, Skin
CR561876 5 µg

Tissue Total RNA, Skin

Sign In for Pricing
View Details
Clec4a3 Mouse Gene Knockout Kit (CRISPR)
KN503445 1 Kit

Clec4a3 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details