Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RCC1L Peptide - N-terminal region

RCC1L Peptide - N-terminal region

Product Specifications

Product Name Alternative

WBSCR16

UniProt

Q8IW88

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with RCC1L Rabbit Polyclonal Antibody (orb326818) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

AAH40695

Preservative

Lyophilized powder

AA Sequence

GYGFTLLSSKTADVTKVWGMGLNKDSQLGFHRSRKDKTRGYEYVLEPSPV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HA tag, AlpHcAbs® Mouse IgG1
HA710213 100 µg

HA tag, AlpHcAbs® Mouse IgG1

Sign In for Pricing
View Details
PLS1 (NM_001145319) Human Over-expression Lysate
LC428822 20 µg

PLS1 (NM_001145319) Human Over-expression Lysate

Sign In for Pricing
View Details
4-Sulfophthalic Acid Trisodium Salt (Contains up to 20% Positional Isomer)
TRC-S579160-250MG 250 mg

4-Sulfophthalic Acid Trisodium Salt (Contains up to 20% Positional Isomer)

Sign In for Pricing
View Details
Recombinant YBX1 Antibody
RC-5973-01 50 μL

Recombinant YBX1 Antibody

Sign In for Pricing
View Details
Recombinant YBX1 Antibody
RC-5973-02 100 µL

Recombinant YBX1 Antibody

Sign In for Pricing
View Details
Recombinant YBX1 Antibody
RC-5973-03 1 mL

Recombinant YBX1 Antibody

Sign In for Pricing
View Details