Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PCBP1 Peptide - middle region

PCBP1 Peptide - middle region

Product Specifications

Product Name Alternative

HNRPE1, HNRPX, hnRNP-E1, hnRNP-X

UniProt

Q15365

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PCBP1 Rabbit Polyclonal Antibody (orb330139) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

IHC, WB

NCBI Accession Number

NP_006187

Preservative

Lyophilized powder

AA Sequence

PHATHDLEGPPLDAYSIQGQHTISPLDLAKLNQVARQQSHFAMMHGGTGF

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Bovine Cytochrome P450 2C18 (CYP2C18) ELISA Kit
MBS7209089-01 48 Well

Bovine Cytochrome P450 2C18 (CYP2C18) ELISA Kit

Sign In for Pricing
View Details
Bovine Cytochrome P450 2C18 (CYP2C18) ELISA Kit
MBS7209089-02 96 Well

Bovine Cytochrome P450 2C18 (CYP2C18) ELISA Kit

Sign In for Pricing
View Details
Bovine Cytochrome P450 2C18 (CYP2C18) ELISA Kit
MBS7209089-03 5x 96 Well

Bovine Cytochrome P450 2C18 (CYP2C18) ELISA Kit

Sign In for Pricing
View Details
Bovine Cytochrome P450 2C18 (CYP2C18) ELISA Kit
MBS7209089-04 10x 96 Well

Bovine Cytochrome P450 2C18 (CYP2C18) ELISA Kit

Sign In for Pricing
View Details
CP Protein Vector (Mouse) (pPM-C-His)
PV167589 500 ng

CP Protein Vector (Mouse) (pPM-C-His)

Sign In for Pricing
View Details
Mrap2 3'UTR Luciferase Stable Cell Line
TU113379 1.0 mL

Mrap2 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details