Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mboat2 Peptide - middle region

Mboat2 Peptide - middle region

Product Specifications

Product Name Alternative

Oact2

UniProt

Q3T1J2

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Mboat2 Rabbit Polyclonal Antibody (orb580680) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001101486

Preservative

Lyophilized powder

AA Sequence

GMFRKDEELTPSQRGLAVRRMPSLLEYVSYTCNFMGILAGPLCSYKDYIA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Goat Anti-Rabbit IgG-AP
4030-04 1.0 mL

Goat Anti-Rabbit IgG-AP

Sign In for Pricing
View Details
LEP (Leptin, FLJ94114, OB, OBS) (Biotin)
248126-Biotin 100 µL

LEP (Leptin, FLJ94114, OB, OBS) (Biotin)

Sign In for Pricing
View Details
Human Uncharacterized protein C9orf114, C9orf114 ELISA Kit
MBS9330597-01 48 Well

Human Uncharacterized protein C9orf114, C9orf114 ELISA Kit

Sign In for Pricing
View Details
Human Uncharacterized protein C9orf114, C9orf114 ELISA Kit
MBS9330597-02 96 Well

Human Uncharacterized protein C9orf114, C9orf114 ELISA Kit

Sign In for Pricing
View Details
Human Uncharacterized protein C9orf114, C9orf114 ELISA Kit
MBS9330597-03 5x 96 Well

Human Uncharacterized protein C9orf114, C9orf114 ELISA Kit

Sign In for Pricing
View Details
Human Uncharacterized protein C9orf114, C9orf114 ELISA Kit
MBS9330597-04 10x 96 Well

Human Uncharacterized protein C9orf114, C9orf114 ELISA Kit

Sign In for Pricing
View Details