Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Man1c1 Peptide - C-terminal region

Man1c1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

AI593348

UniProt

Q6NXK9

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Man1c1 Rabbit Polyclonal Antibody (orb580757) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_997120

Preservative

Lyophilized powder

AA Sequence

ESYMYLWRQTHDPIYREWGWEVVMALEKHCRTEAGFSGIQDVYSSNPNHD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Hepatitis C virus
bs-72582G 100 µg

Hepatitis C virus

Sign In for Pricing
View Details
PCCA Antibody (Center) [APR08965G]
APR08965G-01 50 µL

PCCA Antibody (Center) [APR08965G]

Sign In for Pricing
View Details
PCCA Antibody (Center) [APR08965G]
APR08965G-02 100 µL

PCCA Antibody (Center) [APR08965G]

Sign In for Pricing
View Details
PCCA Antibody (Center) [APR08965G]
APR08965G-03 200 µL

PCCA Antibody (Center) [APR08965G]

Sign In for Pricing
View Details
PCCA Antibody (Center) [APR08965G]
APR08965G-04 400 µL

PCCA Antibody (Center) [APR08965G]

Sign In for Pricing
View Details
Rabbit Polyclonal R-Spondin 3 Antibody [DyLight 650]
NBP2-81849C 0.1 mL

Rabbit Polyclonal R-Spondin 3 Antibody [DyLight 650]

Sign In for Pricing
View Details