Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Man1c1 Peptide - C-terminal region

Man1c1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

AI593348

UniProt

Q6NXK9

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Man1c1 Rabbit Polyclonal Antibody (orb580757) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_997120

Preservative

Lyophilized powder

AA Sequence

ESYMYLWRQTHDPIYREWGWEVVMALEKHCRTEAGFSGIQDVYSSNPNHD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-Mouse CD45RB-PE Conjugate Antibody
MBS4151736-01 0.1 mg

Anti-Mouse CD45RB-PE Conjugate Antibody

Sign In for Pricing
View Details
Anti-Mouse CD45RB-PE Conjugate Antibody
MBS4151736-02 5x 0.1 mg

Anti-Mouse CD45RB-PE Conjugate Antibody

Sign In for Pricing
View Details
ALPPL2 Recombinant Protein (Human)
RP046486 100 µg

ALPPL2 Recombinant Protein (Human)

Sign In for Pricing
View Details
Anti-RFP | Red Fluorescent Protein (clone RF5R)
AS15 3028 50 µg

Anti-RFP | Red Fluorescent Protein (clone RF5R)

Sign In for Pricing
View Details
Rat OxLDL (Oxidized low-density lipoprotein) ELISA Kit
EKF58185 96 Tests

Rat OxLDL (Oxidized low-density lipoprotein) ELISA Kit

Sign In for Pricing
View Details
90/10% Pt/Ir Wire, 30 Gauge
59-1M30PI 1 Meter/Unit

90/10% Pt/Ir Wire, 30 Gauge

Sign In for Pricing
View Details