RGD1305007 Peptide - N-terminal region
RGD1305007 Peptide - N-terminal region
Product Specifications
Product Name Alternative
RGD1305007
UniProt
Q5M843
Field of Research
Metabolism Research
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with RGD1305007 Rabbit Polyclonal Antibody (orb325517) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_001013998
Preservative
Lyophilized powder
AA Sequence
RFEGCTPRKCGRGVTDIVITREEAEQIRRIAEKGLSLGGSDGGASILDLH
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC040026-100 1x 100 µL
ACTH (Adrenocorticotrophic Hormone) (AH26), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC400745-100 1x 100 µL
CD45 / LCA (2B11 + PD7/26), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC040218-100 1x 100 µL
CD100 (Semaphorin-4D) (A8), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC681003-500 1x 500 µL
Mucin 5AC (MUC5AC) (58M1), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC040460-500 1x 500 µL
CD44 Standard (156-3C11), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details