Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Vps45 Peptide - C-terminal region

Vps45 Peptide - C-terminal region

Product Specifications

Product Name Alternative

AI462172, AW554165, mVps45

UniProt

P97390

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Vps45 Rabbit Polyclonal Antibody (orb330676) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_038869

Preservative

Lyophilized powder

AA Sequence

PFLHETLDHLIKGRLKENLYPYLGPSTLRDRPQDIIVFIIGGATYEEALT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ACSM3 Antibody
GWB-MW072I 50 µg

ACSM3 Antibody

Sign In for Pricing
View Details
Recombinant Uncultured termite group 1 bacterium phylotype Rs-D17 GTPase obg (obg)
MBS1084843-01 0.02 mg (E-Coli)

Recombinant Uncultured termite group 1 bacterium phylotype Rs-D17 GTPase obg (obg)

Sign In for Pricing
View Details
Recombinant Uncultured termite group 1 bacterium phylotype Rs-D17 GTPase obg (obg)
MBS1084843-02 0.02 mg (Yeast)

Recombinant Uncultured termite group 1 bacterium phylotype Rs-D17 GTPase obg (obg)

Sign In for Pricing
View Details
Recombinant Uncultured termite group 1 bacterium phylotype Rs-D17 GTPase obg (obg)
MBS1084843-03 0.1 mg (E-Coli)

Recombinant Uncultured termite group 1 bacterium phylotype Rs-D17 GTPase obg (obg)

Sign In for Pricing
View Details
Recombinant Uncultured termite group 1 bacterium phylotype Rs-D17 GTPase obg (obg)
MBS1084843-04 0.1 mg (Yeast)

Recombinant Uncultured termite group 1 bacterium phylotype Rs-D17 GTPase obg (obg)

Sign In for Pricing
View Details
Recombinant Uncultured termite group 1 bacterium phylotype Rs-D17 GTPase obg (obg)
MBS1084843-05 0.02 mg (Baculovirus)

Recombinant Uncultured termite group 1 bacterium phylotype Rs-D17 GTPase obg (obg)

Sign In for Pricing
View Details