Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Vps45 Peptide - C-terminal region

Vps45 Peptide - C-terminal region

Product Specifications

Product Name Alternative

AI462172, AW554165, mVps45

UniProt

P97390

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Vps45 Rabbit Polyclonal Antibody (orb330676) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_038869

Preservative

Lyophilized powder

AA Sequence

PFLHETLDHLIKGRLKENLYPYLGPSTLRDRPQDIIVFIIGGATYEEALT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Apol9b (NM_001168660) Mouse Untagged Clone
MC211242 10 µg

Apol9b (NM_001168660) Mouse Untagged Clone

Sign In for Pricing
View Details
Cstf3-set siRNA/shRNA/RNAi Lentivector (Mouse)
16992094 4x 500 ng

Cstf3-set siRNA/shRNA/RNAi Lentivector (Mouse)

Sign In for Pricing
View Details
SERPINA1 Rabbit mAb Antibody
orb1951222-01 50 µL

SERPINA1 Rabbit mAb Antibody

Sign In for Pricing
View Details
SERPINA1 Rabbit mAb Antibody
orb1951222-02 100 µL

SERPINA1 Rabbit mAb Antibody

Sign In for Pricing
View Details
Anti-Neu4 Antibody
MBS8307419-01 0.03 mL

Anti-Neu4 Antibody

Sign In for Pricing
View Details
Anti-Neu4 Antibody
MBS8307419-02 0.05 mL

Anti-Neu4 Antibody

Sign In for Pricing
View Details