Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Paox Peptide - middle region

Paox Peptide - middle region

Product Specifications

UniProt

D3Z8W0

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Paox Rabbit Polyclonal Antibody (orb582244) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001099781

Preservative

Lyophilized powder

AA Sequence

FQLAAEFGLLGEKELSEENQLVETGGHVALPSVSCTSSGTSVSLELVTEM

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

AMPK alpha 1 Antibody
OC-830-01 50 μL

AMPK alpha 1 Antibody

Sign In for Pricing
View Details
AMPK alpha 1 Antibody
OC-830-02 100 µL

AMPK alpha 1 Antibody

Sign In for Pricing
View Details
AMPK alpha 1 Antibody
OC-830-03 1 mL

AMPK alpha 1 Antibody

Sign In for Pricing
View Details
p16INK4A (CDKN2A) (NM_001195132) Human Over-expression Lysate
LC434008 20 µg

p16INK4A (CDKN2A) (NM_001195132) Human Over-expression Lysate

Sign In for Pricing
View Details
Laminin (A5), CF543 conjugate, 0.1mg/mL
BNC430308-500 1x 500 µL

Laminin (A5), CF543 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
HNRNPA0 Recombinant Rabbit monoclonal Antibody
HA750832 100 µL

HNRNPA0 Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details