Paox Peptide - middle region
Paox Peptide - middle region
Product Specifications
UniProt
D3Z8W0
Field of Research
Metabolism Research
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with Paox Rabbit Polyclonal Antibody (orb582244) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_001099781
Preservative
Lyophilized powder
AA Sequence
FQLAAEFGLLGEKELSEENQLVETGGHVALPSVSCTSSGTSVSLELVTEM
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
GAF-541-10 1 mL
Colloidal Gold Conjugated Rabbit Purified Antibody to Mouse IgG, 10nm
Sign In for Pricing
View Details 
![Phospho-AKT (S473) Recombinant Rabbit Monoclonal Antibody [SY28-05]](https://cdn.genprice.uk/products/992/68dd1c8c061270361ea81b4a/imageurl/et1607-73.webp)
ET1607-73 100 µL
Phospho-AKT (S473) Recombinant Rabbit Monoclonal Antibody [SY28-05]
Sign In for Pricing
View Details 
BNC941968-500 1x 500 µL
Thyroglobulin (Thyroidal Cell Marker) (TGB/1968R), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 