Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Traf3ip1 Peptide - N-terminal region

Traf3ip1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

3930402D05Rik, AU041749, MIP-T3

UniProt

Q149C2

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Traf3ip1 Rabbit Polyclonal Antibody (orb330806) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_082994

Preservative

Lyophilized powder

AA Sequence

VIRITGFMKGLYTDAEMKSENVKDKDAKISFLQKAIDVVMMVSGEPLAAK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit TBP (TATA Binding Protein) ValidElisa Kit
EK346206 96 Well

Rabbit TBP (TATA Binding Protein) ValidElisa Kit

Sign In for Pricing
View Details
Salbutamol antibody
10-1580 200 µg

Salbutamol antibody

Sign In for Pricing
View Details
ZNF45 Human shRNA Plasmid Kit (Locus ID 7596)
TL308169 1 Kit

ZNF45 Human shRNA Plasmid Kit (Locus ID 7596)

Sign In for Pricing
View Details
BMS-986020
TRC-B701320-50MG 50 mg

BMS-986020

Sign In for Pricing
View Details
LRRTM2 Polyclonal Antibody, Cy7 Conjugated
bs-11877R-Cy7 100 µL

LRRTM2 Polyclonal Antibody, Cy7 Conjugated

Sign In for Pricing
View Details
Lentiviral mouse Arrdc2 shRNA (UAS) - Lentiviral mouse Arrdc2 shRNA (UAS, GFP) (100)
GTR15165417 1 Vial

Lentiviral mouse Arrdc2 shRNA (UAS) - Lentiviral mouse Arrdc2 shRNA (UAS, GFP) (100)

Sign In for Pricing
View Details