Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Gpx7 Peptide - C-terminal region

Gpx7 Peptide - C-terminal region

Product Specifications

UniProt

D3ZQI1

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Gpx7 Rabbit Polyclonal Antibody (orb325978) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001100143

Preservative

Lyophilized powder

AA Sequence

RTYSVSFPMFSKIAVTGTGAHPAFKYLTQTSGKEPTWNFWKYLVAPDGKV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MAPK14 Rabbit Polyclonal Antibody
R1308-3 100 µL

MAPK14 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Tmem145 Mouse Gene Knockout Kit (CRISPR)
KN517731 1 Kit

Tmem145 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Human ARGLU1 activation kit by CRISPRa
GA110501 1 Kit

Human ARGLU1 activation kit by CRISPRa

Sign In for Pricing
View Details
C16orf87 (NM_001001436) Human Over-expression Lysate
LC424354 20 µg

C16orf87 (NM_001001436) Human Over-expression Lysate

Sign In for Pricing
View Details
AKT1 Recombinant Rabbit monoclonal Antibody
HA750177 100 µL

AKT1 Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
Cox2 Antibody
8C0160-AAT 50 µg

Cox2 Antibody

Sign In for Pricing
View Details