Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Gpx7 Peptide - C-terminal region

Gpx7 Peptide - C-terminal region

Product Specifications

UniProt

D3ZQI1

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Gpx7 Rabbit Polyclonal Antibody (orb325978) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001100143

Preservative

Lyophilized powder

AA Sequence

RTYSVSFPMFSKIAVTGTGAHPAFKYLTQTSGKEPTWNFWKYLVAPDGKV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue FFPE Sections, Lung: right upper lobe
CS713625 5x 5 µm

Tissue FFPE Sections, Lung: right upper lobe

Sign In for Pricing
View Details
Vasopressin Acetic Acid Salt
TRC-V991535-100MG 100 mg

Vasopressin Acetic Acid Salt

Sign In for Pricing
View Details
Mouse IgG2b (Fcγ Fragment specific), AlpSdAbs® VHH (Biotin)
HA710198 100 µg

Mouse IgG2b (Fcγ Fragment specific), AlpSdAbs® VHH (Biotin)

Sign In for Pricing
View Details
Recombinant Caspase-3 Antibody
RC-4181-01 50 μL

Recombinant Caspase-3 Antibody

Sign In for Pricing
View Details
Recombinant Caspase-3 Antibody
RC-4181-02 100 µL

Recombinant Caspase-3 Antibody

Sign In for Pricing
View Details
Recombinant Caspase-3 Antibody
RC-4181-03 1 mL

Recombinant Caspase-3 Antibody

Sign In for Pricing
View Details