Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Ralb Peptide - middle region

Ralb Peptide - middle region

Product Specifications

Product Name Alternative

5730472O18Rik

UniProt

Q9JIW9

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Ralb Rabbit Polyclonal Antibody (orb330852) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_071722

Preservative

Lyophilized powder

AA Sequence

EHESFTATAEFREQILRVKSEEDKIPLLVVGNKSDLEERRQVPVDEARGK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ZNF628 siRNA (Mouse)
orb1836264-01 15 nmol

ZNF628 siRNA (Mouse)

Sign In for Pricing
View Details
ZNF628 siRNA (Mouse)
orb1836264-02 30 nmol

ZNF628 siRNA (Mouse)

Sign In for Pricing
View Details
C10orf31 Protein Vector (Human) (pPB-His-MBP)
PV328154 500 ng

C10orf31 Protein Vector (Human) (pPB-His-MBP)

Sign In for Pricing
View Details
SP140 Rabbit Polyclonal Antibody (Cy7)
orb1069248 100 µL

SP140 Rabbit Polyclonal Antibody (Cy7)

Sign In for Pricing
View Details
Heptanoyl-L-carnitine (chloride)
T38232-01 5 mg

Heptanoyl-L-carnitine (chloride)

Sign In for Pricing
View Details
Heptanoyl-L-carnitine (chloride)
T38232-02 10 mg

Heptanoyl-L-carnitine (chloride)

Sign In for Pricing
View Details