Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Rala Peptide - N-terminal region

Rala Peptide - N-terminal region

Product Specifications

UniProt

P63322

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Rala Rabbit Polyclonal Antibody (orb330874) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_112355

Preservative

Lyophilized powder

AA Sequence

AANKPKGQNSLALHKVIMVGSGGVGKSALTLQFMYDEFVEDYEPTKADSY

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

G-CSFR Polyclonal Antibody
E20-75069 100 µg

G-CSFR Polyclonal Antibody

Sign In for Pricing
View Details
STX11, NT (STX11, Syntaxin-11) (Biotin) discontinued
042430-Biotin 200 µL

STX11, NT (STX11, Syntaxin-11) (Biotin) discontinued

Sign In for Pricing
View Details
BZW1 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)
LV678717 1.0 µg DNA

BZW1 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)

Sign In for Pricing
View Details
Human Cathepsin D ELISA Kit
BEK1023 96 Tests

Human Cathepsin D ELISA Kit

Sign In for Pricing
View Details
FKHR, ID (D469) (Forkhead Box Protein O1, Forkhead Box Protein O1A, Forkhead In Rhabdomyosarcoma, FOXO1A, FOXO1) (MaxLight 550)
MBS6476571-01 0.1 mL

FKHR, ID (D469) (Forkhead Box Protein O1, Forkhead Box Protein O1A, Forkhead In Rhabdomyosarcoma, FOXO1A, FOXO1) (MaxLight 550)

Sign In for Pricing
View Details
FKHR, ID (D469) (Forkhead Box Protein O1, Forkhead Box Protein O1A, Forkhead In Rhabdomyosarcoma, FOXO1A, FOXO1) (MaxLight 550)
MBS6476571-02 5x 0.1 mL

FKHR, ID (D469) (Forkhead Box Protein O1, Forkhead Box Protein O1A, Forkhead In Rhabdomyosarcoma, FOXO1A, FOXO1) (MaxLight 550)

Sign In for Pricing
View Details