Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Rala Peptide - N-terminal region

Rala Peptide - N-terminal region

Product Specifications

UniProt

P63322

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Rala Rabbit Polyclonal Antibody (orb330874) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_112355

Preservative

Lyophilized powder

AA Sequence

AANKPKGQNSLALHKVIMVGSGGVGKSALTLQFMYDEFVEDYEPTKADSY

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

EPM2™, 500 ml
402 500 mL

EPM2™, 500 ml

Sign In for Pricing
View Details
Ints9 (NM_153414) Mouse Tagged ORF Clone Lentiviral Particle
MR216715L4V 200 µL

Ints9 (NM_153414) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
COPS8 3'UTR Lenti-reporter-Luc Vector
16637081 1.0 µg

COPS8 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details
Conjugated MARK2 Rabbit mAb
C59900 100 µL

Conjugated MARK2 Rabbit mAb

Sign In for Pricing
View Details
PCMV-3xMyc-ATP13A2-Neo Plasmid
PVT63553 2 µg

PCMV-3xMyc-ATP13A2-Neo Plasmid

Sign In for Pricing
View Details
Rnf25 Mouse qPCR Primer Pair (NM_021313)
MP214806 200 Reactions

Rnf25 Mouse qPCR Primer Pair (NM_021313)

Sign In for Pricing
View Details