Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mrpl48 Peptide - C-terminal region

Mrpl48 Peptide - C-terminal region

Product Specifications

UniProt

D3ZDX7

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Mrpl48 Rabbit Polyclonal Antibody (orb583326) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001099752

Preservative

Lyophilized powder

AA Sequence

ISGLSATFAEIFLEILQINLPEGVRLSVREHTEEDFKGRFKARPELEELL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Horse Sphingosine (SPH) ELISA Kit
QY-E120113 96 Tests

Horse Sphingosine (SPH) ELISA Kit

Sign In for Pricing
View Details
Ugt2b1 AAV siRNA Pooled Vector
49128166 1.0 µg

Ugt2b1 AAV siRNA Pooled Vector

Sign In for Pricing
View Details
Recombinant Mouse SLC35E4 Protein, His (Fc)-Avi-tagged
SLC35E4-8341M 50 µg

Recombinant Mouse SLC35E4 Protein, His (Fc)-Avi-tagged

Sign In for Pricing
View Details
Annexin III Polyclonal Antibody
E20-70237 100 µg

Annexin III Polyclonal Antibody

Sign In for Pricing
View Details
MDH2, Recombinant, Human, aa25-338, His-Tag (Malate Dehydrogenase, Mitochondrial 2)
M2115-39 50 µg

MDH2, Recombinant, Human, aa25-338, His-Tag (Malate Dehydrogenase, Mitochondrial 2)

Sign In for Pricing
View Details
GIF Antibody
OACA03020-50UG 50 µg

GIF Antibody

Sign In for Pricing
View Details