Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Prcc Peptide - C-terminal region

Prcc Peptide - C-terminal region

Product Specifications

UniProt

B2RYA6

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Prcc Rabbit Polyclonal Antibody (orb583723) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001101170

Preservative

Lyophilized powder

AA Sequence

KKKGEQPTGQQRRKHQITYLIHQAKERELELKNTWSENKLSRRQTQAKYG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Rat CD133/PROM1/Prominin 1 Protein (Fc Tag)
PKSR030231 100 µg

Recombinant Rat CD133/PROM1/Prominin 1 Protein (Fc Tag)

Sign In for Pricing
View Details
HLTF (Center) Rabbit Polyclonal Antibody
AP17466PU-N 400 µL

HLTF (Center) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
ARID3C (NM_001017363) Human Recombinant Protein
TP317747L 1 mg

ARID3C (NM_001017363) Human Recombinant Protein

Sign In for Pricing
View Details
Human DISC1 activation kit by CRISPRa
GA109058 1 Kit

Human DISC1 activation kit by CRISPRa

Sign In for Pricing
View Details
Mouse Adra2b activation kit by CRISPRa
GA200102 1 Kit

Mouse Adra2b activation kit by CRISPRa

Sign In for Pricing
View Details
1,2,3,7,8-Pentachlorodibenzo-p-dioxin (>85%)
TRC-P237953-25MG 25 mg

1,2,3,7,8-Pentachlorodibenzo-p-dioxin (>85%)

Sign In for Pricing
View Details